PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G133200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 380aa    MW: 40244.9 Da    PI: 7.0644
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G133200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.2e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l+ +++q+G g+W++ +++ g+ R++k+c++rw +yl
  Sevir.7G133200.1.p 14 KGPWTPEEDQKLLAYIEQHGHGCWRSLPAKAGLQRCGKSCRLRWTNYL 61
                        79********************************************97 PP

2Myb_DNA-binding52.98.4e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Sevir.7G133200.1.p  67 RGKFSLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.026961IPR017930Myb domain
SuperFamilySSF466895.62E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001676.82E-121661No hitNo description
PROSITE profilePS5129425.89162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2665116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002494.5E-1667112IPR001005SANT/Myb domain
CDDcd001671.60E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MGRSPCCDKE GLKKGPWTPE EDQKLLAYIE QHGHGCWRSL PAKAGLQRCG KSCRLRWTNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLAKMG  120
IDPVTHKPRS DALGAGGAGG AAAGAQHAKA AAHLSHTAQW ESARLEAEAR LAREARLRAL  180
AASASVSAPA PSSAAHGLES PTSTLSFSES AALASVLEAH GAAAAAAAAR AAMQPMQAYE  240
EACKEHEQQQ QQLWGDHVVH AADAAFAGAG FTGLLLEGAL NQLQQDLRPA ARHGAGDDAG  300
LQETEEEKNY WDSILNLVNS SSVSQPTSVA APTPEAYSSS ASLTTSVVVT APEAYSSSTS  360
LTTSIAVPPP EAYSPAPEF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3603780.0AK360378.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1116O14.
GenBankJF9519180.0JF951918.1 Triticum aestivum clone TaMYB16 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975862.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLK3Y8110.0K3Y811_SETIT; Uncharacterized protein
STRINGSi010352m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.12e-89myb domain protein 16